PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family bZIP
Protein Properties Length: 365aa    MW: 40612.7 Da    PI: 10.1965
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01102genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.33.8e-0976120953
               CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
    bZIP_1   9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
               r + NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l+ l+
  EMT01102  76 RIMANRQSAARSKERKMRYIAELERKVQCLQTEATTLSAQLSLLQ 120
               6789**********************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS502178.88770120IPR004827Basic-leucine zipper domain
SMARTSM003387.9E-871132IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-1176121No hitNo description
SuperFamilySSF579596.19E-1076127No hitNo description
CDDcd147031.25E-1876121No hitNo description
PfamPF001703.7E-876120IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSMDGSTSFG SASSGVSGRH GADAKKAISD AKLAELALVD PKRAKRDSRN IGYRIAAVDR  60
DRLDGFCLFE KESSPRIMAN RQSAARSKER KMRYIAELER KVQCLQTEAT TLSAQLSLLQ  120
AYQYIIHKVL SEAIAISTVL TMTKGKETAP AGEVAFHVRD QRSESREVEL GWAAGEAMKA  180
HPRLESTNRE RQDHLDVGHS QKVPNPLRDT SGLTNENGDL KLQVQTMEQQ VRLQDALNDR  240
LRVQQLKIAT GQLNANNGNL GNFGGLSSYG VNPQSYQRSQ MQQQSLLAAQ QLQQLQIHSQ  300
HQQPQMHMQQ QRLASVRQQQ QQQQQQSQLR PEALPFPGDL KMKGIAMTAH VQNAGPFDGR  360
ARSEP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668881e-147AK366888.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047M20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580055.12e-44PREDICTED: transcription factor RF2a-like
TrEMBLR7W2400.0R7W240_AEGTA; Transcription factor RF2a
STRINGMLOC_64362.17e-46(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.14e-20bZIP family protein